PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy021106
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 268aa    MW: 30450.2 Da    PI: 6.1779
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S58467545PU_refUnigeneView CDS
PUT-171a-Arachis_hypogaea-27286PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS315.41.3e-96226743310
       GRAS  43 ayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppsl 142
                ay++e+L+ar  +s+s +ykal++++ +   s++ +++++++++++P+ kf+++ aN  I ea+++e r+HiiDf+i qG+QW  L+qaLa Rp+gpps+
  Ahy021106   2 AYMLEGLRARFESSGSLIYKALKCEQPT---SKDLMTYMHVLYQICPYWKFAYISANVVIGEAMQNEARIHIIDFQIAQGTQWFLLMQALARRPGGPPSI 98 
                8**************************9...9999999************************************************************** PP

       GRAS 143 RiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvv 240
                R+Tg+++++s+  +   l+ +g++L+++A++lgvpfef+  +a +  ++ele+L ++pgEalaVn+ + lh+++desv++e++rd++L+lvkslsPkvv+
  Ahy021106  99 RVTGIDDSQSNhaRGGGLHIVGKKLSEYANSLGVPFEFHS-AAMEDXEVELENLVIRPGEALAVNFPFVLHHMPDESVTTENHRDRLLRLVKSLSPKVVT 197
                *******9988889999***********************.8889999**************************************************** PP

       GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhe 310
                +veqe+++n+++F++rf+e+l+yy+a+f+s+++  pr++++ri+ E+++++r+ivn++aceg er+erhe
  Ahy021106 198 LVEQESNTNTSPFFQRFVETLNYYTAMFESIDVARPRDDKQRISAEQHCVARDIVNMIACEGPERVERHE 267
                *********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.4121268IPR005202Transcription factor GRAS
PfamPF035144.4E-942267IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
XAYMLEGLRA RFESSGSLIY KALKCEQPTS KDLMTYMHVL YQICPYWKFA YISANVVIGE  60
AMQNEARIHI IDFQIAQGTQ WFLLMQALAR RPGGPPSIRV TGIDDSQSNH ARGGGLHIVG  120
KKLSEYANSL GVPFEFHSAA MEDXEVELEN LVIRPGEALA VNFPFVLHHM PDESVTTENH  180
RDRLLRLVKS LSPKVVTLVE QESNTNTSPF FQRFVETLNY YTAMFESIDV ARPRDDKQRI  240
SAEQHCVARD IVNMIACEGP ERVERHEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-473026573307GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015958991.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M51e-147SCL13_ARATH; Scarecrow-like protein 13
TrEMBLI1L0131e-175I1L013_SOYBN; Uncharacterized protein
STRINGGLYMA09G01440.11e-174(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.11e-148SCARECROW-like 13